Janoshik-Certified
Every Batch Third-Party Tested
Latest COAs Available
Research Grade Purity
Research Use Only
Janoshik-Certified
Every Batch Third-Party Tested
Latest COAs Available
Research Grade Purity
Research Use Only
Metabolic Complete R30
Original price was: RM750.00.RM675.00Current price is: RM675.00.
RETATRUTIDE 20MG
RM330.00
RETATRUTIDE 10MG
RM270.00
C221H342N46O68
A peptide studied for weight regulation and metabolic research. Acts on three hormone pathways at once.
In stock — ships from Malaysia
Description
Description
Key Research Findings
- TRIUMPH-1 (May 2026) — Eli Lilly reported average weight reduction of 28.3% at 80 weeks and 30.3% at 104 weeks across 2,339 participants. All doses met their primary and key secondary endpoints.
- TRIUMPH-4 (December 2025) — up to 28.7% weight reduction alongside reductions in knee pain in adults with obesity and knee osteoarthritis.
- TRIUMPH-3 (2026) — reported in adults with obesity or overweight and established cardiovascular disease.
- Seven further phase 3 readouts are due in 2026; Lilly plans a US regulatory submission in Q1 2027.
Published trial results, provided as scientific background only. They describe research in clinical populations and do not indicate any approved or intended use of this product.
Overview
- A synthetic peptide developed by Eli Lilly, known in research literature as LY-3437943 or “Triple G”.
- Acts on three hormone receptors at the same time — that combination is what makes it unusual among metabolic peptides.
- Studied for body weight, blood sugar control, liver fat and heart-related measures.
How It Works
- Triggers three receptors that normally respond to gut and pancreatic hormones: GLP-1, GIP and glucagon.
- GLP-1 signal — reduces appetite, slows stomach emptying, and helps insulin release when blood sugar rises.
- GIP signal — supports the insulin response and changes how fat cells handle energy.
- Glucagon signal — increases the rate at which the body burns energy and releases stored fat.
- Binds most strongly to the GIP receptor of the three.
- A fatty-acid chain attached to the peptide makes it stick to proteins in the blood, so it stays active long enough for once-weekly dosing in trials.
Research Effects
Human Clinical Trials
Body Weight Reduction
Average reductions of 28.3% at 80 weeks and 30.3% at 104 weeks reported in the phase 3 TRIUMPH-1 trial.
Human Clinical Trials
Blood Sugar Control
Improvements in glycaemic measures and A1C reported across phase 2 and phase 3 trials.
Human Clinical Trials
Liver Fat
Reductions in liver fat content reported in clinical research.
Human Clinical Trials
Cholesterol & Triglycerides
Changes in triglycerides and LDL reported in published trial data.
Human Clinical Trials
Appetite & Fullness
Reduced appetite and altered fullness signalling described in trial reports.
Human Clinical Trials
Cardiometabolic Measures
Reported in TRIUMPH-3, in adults with obesity or overweight and established cardiovascular disease.
Lab & Animal Studies
Energy Burn Rate
Increased energy expenditure attributed to glucagon receptor activity, characterised mainly in laboratory and animal studies.
Human Clinical Trials — reported in published human trial dataLab & Animal Studies — laboratory or animal studies only
Amino Acid Sequence
YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS-NH239-amino acid synthetic peptide (single-letter code). Modifications: Aib = 2-aminoisobutyric acid at positions 2 and 20; α-Me-Leu = α-methyl-L-leucine at position 13; Lys17 carries a C20 fatty diacid–γ-Glu–AEEA spacer side chain; C-terminal serinamide.
View the full research library →
Research use only. Sold strictly for research and laboratory use only. Not for human or animal consumption. Not for diagnostic, therapeutic or clinical use. Citations describe research contexts and do not imply approval for human use.
Related products
